ADARB2 anticorps

N° du produit ABIN633530

L’anticorps Lapin Polyclonal anti-ADARB2 a été validé pour WB. Il convient pour détecter ADARB2 dans des échantillons de Humain.

Aperçu rapide pour ADARB2 anticorps (ABIN633530)

Antigène: ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADARB2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADARB2 anticorps

Purification: Affinity purified

Immunogène: ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADARB2 Blocking Peptide, ABIN5611942, is also available for use as a blocking control in assays to test for specificity of this ADARB2 antibody

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADARB2

Antigène: ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))

Autre désignation: ADARB2

Sujet: ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing.

Poids moléculaire: 80 kDa (MW of target protein)